PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.003G175300.1
Common NameB456_003G175300, LOC105789282
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 331aa    MW: 36370.2 Da    PI: 7.0453
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.003G175300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.51.1e-1194138347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+  ++ + ++lG+g+W+ I+r     Rt+ q+ s+ qky
  Gorai.003G175300.1  94 PWTEEEHRMFLLGLQKLGKGDWRGISRNYVISRTPTQVASHAQKY 138
                         7*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.106.7E-4321IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.17887143IPR017930Myb domain
SuperFamilySSF466898.97E-1789144IPR009057Homeodomain-like
TIGRFAMsTIGR015578.1E-1990142IPR006447Myb domain, plants
SMARTSM007174.0E-991141IPR001005SANT/Myb domain
PfamPF002494.6E-1094138IPR001005SANT/Myb domain
CDDcd001676.86E-994139No hitNo description
Gene3DG3DSA:1.10.10.601.6E-1094137IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MTRRCSHCSH NGHNSRTCPN RGFKLFGVRL TDGLIRKSAS MGNLSQYSGL NSGMHNRNGS  60
GEPGDGPDHA DGYASEDFVP GSSSSNRERK RGIPWTEEEH RMFLLGLQKL GKGDWRGISR  120
NYVISRTPTQ VASHAQKYFI RQSNVSRRKR RSSLFDIVTD ESSDIPMVSH DSFSENPSEA  180
EAQSNDHLPI PPALDEEDET MDTDKSNDGE NIHIPPKPET SQPPYPALYP AYFPPFFPFS  240
LSYWMGYNTE PTKENTHEVV KPMAVHSKIP INVDELVGMS KLSLGESIGG NGPSSVSLKL  300
DGSSRQSAFH ANPVPGNSRM NSSGSPIHAN *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012472056.10.0PREDICTED: transcription factor MYB1R1-like
SwissprotQ2V9B06e-41MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A0D2MQB40.0A0A0D2MQB4_G
STRINGVIT_00s0299g00060.t011e-160(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34262759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-116MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]